PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_42385_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family Trihelix
Protein Properties Length: 290aa    MW: 33530.4 Da    PI: 6.526
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_42385_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix988.3e-31102186186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     rW+k+ev aLi++r  +e+r+ +  lk+plWeevs+ m++ g++rs+k+Ckekwen+nk+++k ke+ kkr s++s+tc yfdql+
  Neem_42385_f_1 102 RWPKDEVEALIQVRIGLESRFLEPGLKGPLWEEVSSLMASMGYQRSAKRCKEKWENINKYFRKAKETGKKR-SPRSKTCTYFDQLD 186
                     8*********************************************************************8.77788********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.02E-25101166No hitNo description
PfamPF138371.8E-21101188No hitNo description
PROSITE profilePS500906.934101159IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MDHQEGLHRK YLEAVHRMDK ERAEREEKWR QQETEKHNRE AIARAHEQSI ASNREDQLIS  60
LIQKITGRSI NLPPRKSALL LQPQLTKEQT KELTGMKGET NRWPKDEVEA LIQVRIGLES  120
RFLEPGLKGP LWEEVSSLMA SMGYQRSAKR CKEKWENINK YFRKAKETGK KRSPRSKTCT  180
YFDQLDQLYS RTPLNLPSSS SNPAFDSDIE QQNQGYSELL EAFAAERDHL GIAQNTSTAG  240
NFDVFEMGSL RLNFDGIPNN QTIEFEQGRH GNENKDCVEE HKVDGEQQVE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002324190.21e-110hypothetical protein POPTR_0018s05540g
TrEMBLB9IKD51e-110B9IKD5_POPTR; Uncharacterized protein
STRINGPOPTR_0018s05540.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16469813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-46Trihelix family protein